PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_12584-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 196aa    MW: 20780.7 Da    PI: 4.3961
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_12584-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.3e-17651148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T eE+e +++++++lG++ W+tIa++++ gRt++++k+ w+++l
  TRIUR3_12584-P1  6 RGNFTCEEEEAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 51
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.821155IPR017930Myb domain
SuperFamilySSF466891.57E-14458IPR009057Homeodomain-like
SMARTSM007171.3E-13553IPR001005SANT/Myb domain
PfamPF002495.7E-15651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-22752IPR009057Homeodomain-like
CDDcd001671.49E-11851No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MAGSKRGNFT CEEEEAIIQL HAMLGNRWST IAARLPGRTD NEIKNVWHTH LKKRLESSSK  60
TSGQAAPKRK AKKPAVAATA SALEGPTSEP ASSSPGQSLS MSPEQSLSTS SATGYSMASS  120
LENTGSSSSE SEEFQIDDSF WSETLAMSVD SSGSGMETGD TFGVDSASTS SSSNDEMDFW  180
VTLFMQASDI ESLSQI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9690510.0JN969051.1 Triticum aestivum MYB73 (MYB73) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.12e-83PREDICTED: myb-related protein Myb4-like
TrEMBLM7ZKA31e-140M7ZKA3_TRIUA; Myb-related protein Myb4
STRINGMLOC_34646.11e-99(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.28e-29myb domain protein 15